Please note: This is a beta version of the new dblp website.
You can find the classic dblp view of this page here.

Tobias Müller

2010 – today

see FAQ

What is the meaning of the colors in the publication list?

2013
[j39]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/MergetZMS13
- ask others
Benjamin Merget, David Zilian, Tobias Müller, Christoph A. Sotriffer: MycPermCheck: the Mycobacterium tuberculosis permeability prediction tool for small molecules. Bioinformatics 29(1): 62-68 (2013)
[j38]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jct/McDiarmidM13
- ask others
Colin McDiarmid, Tobias Müller: Integer realizations of disk and segment graphs. J. Comb. Theory, Ser. B 103(1): 114-143 (2013)
[j37]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/siamdm/MullerLL13
- ask others
Tobias Müller, Erik Jan van Leeuwen, Jan van Leeuwen: Integer Representations of Convex Polygon Intersection Graphs. SIAM J. Discrete Math. 27(1): 205-231 (2013)
2012
[j36]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/BeisserBDKDM12
- ask others
Daniela Beisser, Stefan Brunkhorst, Thomas Dandekar, Gunnar W. Klau, Marcus T. Dittrich, Tobias Müller: Robustness and accuracy of functional modules in integrated network analysis. Bioinformatics 28(14): 1887-1894 (2012)
[j35]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/cpc/BeveridgeDFM12
- ask others
Andrew Beveridge, Andrzej Dudek, Alan M. Frieze, Tobias Müller: Cops and Robbers on Geometric Graphs. Combinatorics, Probability & Computing 21(6): 816-834 (2012)
[j34]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/dcg/KangM12
- ask others
Ross J. Kang, Tobias Müller: Sphere and Dot Product Representations of Graphs. Discrete & Computational Geometry 47(3): 548-568 (2012)
[j33]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/siamdm/KangMM12
- ask others
Ross J. Kang, Matthias Mnich, Tobias Müller: Induced Matchings in Subcubic Planar Graphs. SIAM J. Discrete Math. 26(3): 1383-1411 (2012)
[c25]
- view
  - electronic edition @ mensch-und-computer.de
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/mc/MullerNK12
- ask others
Tobias Müller, Karsten Nebe, Florian Klompmaker: Base Requirements for Virtual Tabletop Groupware Artifacts. Mensch & Computer Workshopband 2012: 461-466
2011
[j32]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/combinatorica/McDiarmidM11
- ask others
Colin McDiarmid, Tobias Müller: On the chromatic number of random geometric graphs. Combinatorica 31(4): 423-488 (2011)
[j31]
- view
  - electronic edition @ combinatorics.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/combinatorics/KangLMS11
- ask others
Ross J. Kang, László Lovász, Tobias Müller, Edward R. Scheinerman: Dot Product Representations of Planar Graphs. Electr. J. Comb. 18(1) (2011)
[j30]
- view
  - electronic edition @ combinatorics.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/combinatorics/MullerPS11
- ask others
Tobias Müller, Attila Pór, Jean-Sébastien Sereni: Graphs with Four Boundary Vertices. Electr. J. Comb. 18(1) (2011)
[j29]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/dam/KangM11
- ask others
Ross J. Kang, Tobias Müller: Frugal, acyclic and star colourings of graphs. Discrete Applied Mathematics 159(16): 1806-1814 (2011)
[j28]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/endm/McDiarmidM11
- ask others
Colin McDiarmid, Tobias Müller: Counting disk graphs. Electronic Notes in Discrete Mathematics 38: 627-632 (2011)
[j27]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jgt/MullerPW11
- ask others
Tobias Müller, Xavier Pérez-Giménez, Nicholas C. Wormald: Disjoint Hamilton cycles in the random geometric graph. Journal of Graph Theory 68(4): 299-322 (2011)
[j26]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/siamdm/BasavarajuCCHM11
- ask others
Manu Basavaraju, L. Sunil Chandran, Nathann Cohen, Frédéric Havet, Tobias Müller: Acyclic Edge-Coloring of Planar Graphs. SIAM J. Discrete Math. 25(2): 463-478 (2011)
[c24]
- view
  - electronic edition @ acm.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/compgeom/MullerLL11
- ask others
Tobias Müller, Erik Jan van Leeuwen, Jan van Leeuwen: Integer representations of convex polygon intersection graphs. Symposium on Computational Geometry 2011: 300-307
[c23]
- view
  - electronic edition @ acm.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/compgeom/KangM11
- ask others
Ross J. Kang, Tobias Müller: Sphere and dot product representations of graphs. Symposium on Computational Geometry 2011: 308-314
[c22]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/hci/NebeMK11
- ask others
Karsten Nebe, Tobias Müller, Florian Klompmaker: An Investigation on Requirements for Co-located Group-Work Using Multitouch-, Pen-Based- and Tangible-Interaction. HCI (2) 2011: 90-99
[c21]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/miccai/BiesdorfWMWHHTR11
- ask others
Andreas Biesdorf, Stefan Wörz, Tobias Müller, Tim Frederik Weber, Tobias Heye, Waldemar Hosch, Hendrik von Tengg-Kobligk, Karl Rohr: Model-Based Segmentation and Motion Analysis of the Thoracic Aorta from 4D ECG-Gated CTA Images. MICCAI (1) 2011: 589-596
[i2]
- view
  - electronic edition @ arxiv.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/corr/abs-1110-3717
- ask others
C. Staiger, Sidney Cadot, R. Kooter, Marcus T. Dittrich, Tobias Müller, Gunnar W. Klau, Lodewyk F. A. Wessels: A critical evaluation of network and pathway based classifiers for outcome prediction in breast cancer. CoRR abs/1110.3717 (2011)
[i1]
- view
  - electronic edition @ arxiv.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/corr/abs-1111-2931
- ask others
Colin McDiarmid, Tobias Müller: Integer realizations of disk and segment graphs. CoRR abs/1111.2931 (2011)
2010
[j25]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/BeisserKDMD10
- ask others
Daniela Beisser, Gunnar W. Klau, Thomas Dandekar, Tobias Müller, Marcus T. Dittrich: BioNet: an R-Package for the functional analysis of biological networks. Bioinformatics 26(8): 1129-1130 (2010)
[j24]
- view
  - electronic edition @ dmtcs.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/dmtcs/BradonjicMP10
- ask others
Milan Bradonjic, Tobias Müller, Allon G. Percus: Coloring Geographical Threshold Graphs. Discrete Mathematics & Theoretical Computer Science 12(3): 103-114 (2010)
[j23]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jgt/Addario-BerryKM10
- ask others
Louigi Addario-Berry, Ross J. Kang, Tobias Müller: Acyclic dominating partitions. Journal of Graph Theory 64(4): 292-311 (2010)
[j22]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/nar/KoetschanFKSRSMWS10
- ask others
Christian Koetschan, Frank Förster, Alexander Keller, Tina Schleicher, Benjamin Ruderisch, Roland Schwarz, Tobias Müller, Matthias Wolf, Jörg Schultz: The ITS2 Database III - sequences and structures for phylogeny. Nucleic Acids Research 38(Database-Issue): 275-279 (2010)
[c20]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/esa/KangMM10
- ask others
Ross J. Kang, Matthias Mnich, Tobias Müller: Induced Matchings in Subcubic Planar Graphs. ESA (2) 2010: 112-122
[c19]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/gd/KangM10
- ask others
Ross J. Kang, Tobias Müller: Dot Product Representations of Planar Graphs. Graph Drawing 2010: 287-292
[c18]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/wg/McDiarmidM10
- ask others
Colin McDiarmid, Tobias Müller: The Number of Bits Needed to Represent a Unit Disk Graph. WG 2010: 315-323

2000 – 2009

see FAQ

What is the meaning of the colors in the publication list?

2009
[j21]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/cpc/MullerS09
- ask others
Tobias Müller, Jean-Sébastien Sereni: Identifying and Locating-Dominating Codes in (Random) Geometric Networks. Combinatorics, Probability & Computing 18(6): 925-952 (2009)
[j20]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/endm/CohenHM09
- ask others
Nathann Cohen, Frédéric Havet, Tobias Müller: Acyclic edge-colouring of planar graphs. Extended abstract. Electronic Notes in Discrete Mathematics 34: 417-421 (2009)
[j19]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/focm/HauserM09
- ask others
Raphael Hauser, Tobias Müller: Conditioning of Random Conic Systems Under a General Family of Input Distributions. Foundations of Computational Mathematics 9(3): 335-358 (2009)
[j18]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jct/MullerW09
- ask others
Tobias Müller, Robert J. Waters: Circular choosability is rational. J. Comb. Theory, Ser. B 99(5): 801-813 (2009)
[j17]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jgt/HavetKMS09
- ask others
Frédéric Havet, Ross J. Kang, Tobias Müller, Jean-Sébastien Sereni: Circular choosability. Journal of Graph Theory 61(4): 241-270 (2009)
[c17]
- view
  - electronic edition @ siam.org
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/analco/BradonjicMP09
- ask others
Milan Bradonjic, Tobias Müller, Allon G. Percus: Coloring Geographical Threshold Graphs. ANALCO 2009: 11-16
[c16]
- view
  - electronic edition @ polytechnique.fr
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/colognetwente/KangM09
- ask others
Ross J. Kang, Tobias Müller: Acyclic and Frugal Colourings of Graphs. CTW 2009: 60-63
2008
[j16]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/WolfRDSM08
- ask others
Matthias Wolf, Benjamin Ruderisch, Thomas Dandekar, Jörg Schultz, Tobias Müller: ProfDistS: (profile-) distance based phylogeny on sequence - structure alignments. Bioinformatics 24(20): 2401-2402 (2008)
[j15]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/combinatorica/Muller08
- ask others
Tobias Müller: Two-point concentration in random geometric graphs. Combinatorica 28(5): 529-545 (2008)
[j14]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/dm/KangMS08
- ask others
Ross J. Kang, Tobias Müller, Jean-Sébastien Sereni: Improper colouring of (random) unit disk graphs. Discrete Mathematics 308(8): 1438-1454 (2008)
[j13]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/dm/MullerPS08
- ask others
Tobias Müller, Attila Pór, Jean-Sébastien Sereni: Lower bounding the boundary of a graph in terms of its maximum or minimum degree. Discrete Mathematics 308(24): 6581-6583 (2008)
[j12]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/nar/SeligWMDS08
- ask others
Christian Selig, Matthias Wolf, Tobias Müller, Thomas Dandekar, Jörg Schultz: The ITS2 Database II: homology modelling RNA structure for molecular systematics. Nucleic Acids Research 36(Database-Issue): 377-380 (2008)
[c15]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/ismb/DittrichKRDM08
- ask others
Marcus T. Dittrich, Gunnar W. Klau, Andreas Rosenwald, Thomas Dandekar, Tobias Müller: Identifying functional modules in protein-protein interaction networks: an integrated exact approach. ISMB 2008: 223-231
2006
[j11]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/FriedrichPDSM06
- ask others
Torben Friedrich, Birgit Pils, Thomas Dandekar, Jörg Schultz, Tobias Müller: Modelling interaction sites in protein domains with interaction profile hidden Markov models. Bioinformatics 22(23): 2851-2857 (2006)
[j10]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bmcbi/SeibelMDSW06
- ask others
Philipp N. Seibel, Tobias Müller, Thomas Dandekar, Jörg Schultz, Matthias Wolf: 4SALE - A tool for synchronous RNA sequence and secondary structure alignment and editing. BMC Bioinformatics 7: 498 (2006)
[j9]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/nar/SchultzMASDW06
- ask others
Jörg Schultz, Tobias Müller, Marco Achtziger, Philipp N. Seibel, Thomas Dandekar, Matthias Wolf: The internal transcribed spacer 2 database - a web server for (not only) low level phylogenetic analyses. Nucleic Acids Research 34(Web-Server-Issue): 704-707 (2006)
2005
[j8]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/FriedrichDWM05
- ask others
Joachim Friedrich, Thomas Dandekar, Matthias Wolf, Tobias Müller: ProfDist: a tool for the construction of large phylogenetic trees based on profile distances. Bioinformatics 21(9): 2108-2109 (2005)
[j7]
- view
  - electronic edition @ bioinfo.de
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/isb/WolfFDM05
- ask others
Matthias Wolf, Joachim Friedrich, Thomas Dandekar, Tobias Müller: CBCAnalyzer: inferring phylogenies based on compensatory base changes in RNA secondary structures. In Silico Biology 5 (2005)
2004
[b1]
- view
  - electronic edition @ uni-saarland.de
- export record as
  - BibTeX
  - XML
  dblp key:
  - phd/de/Muller2004c
- ask others
Tobias Müller: Constraint propagation in Mozart. Saarland University 2004
[j6]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/bioinformatics/CrassABBBCCEEGGGGGHHOKKKLLLLMMMMMMMPRRSSSSSSSTVWWWWZ04
- ask others
Torsten Crass, Iris Antes, Rico Basekow, Peer Bork, Christian Buning, Maik Christensen, Holger Claussen, Christian Ebeling, Peter Ernst, Valérie Gailus-Durner, Karl-Heinz Glatting, Rolf Gohla, Frank Gößling, Korbinian Grote, Karsten R. Heidtke, Alexander Herrmann, Sean O'Keeffe, O. Kießlich, Sven Kolibal, Jan O. Korbel, Thomas Lengauer, Ines Liebich, Mark van der Linden, Hannes Luz, Kathrin Meissner, Christian von Mering, Heinz-Theodor Mevissen, Hans-Werner Mewes, Holger Michael, Martin Mokrejs, Tobias Müller, Heike Pospisil, Matthias Rarey, Jens G. Reich, Ralf Schneider, Dietmar Schomburg, Steffen Schulze-Kremer, Knut Schwarzer, Ingolf Sommer, Stephan Springstubbe, Sándor Suhai, Gnanasekaran Thoppae, Martin Vingron, Jens Warfsmann, Thomas Werner, Daniel Wetzler, Edgar Wingender, Ralf Zimmer: The Helmholtz Network for Bioinformatics: an integrative web portal for bioinformatics resources. Bioinformatics 20(2): 268-270 (2004)
[j5]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/eor/HenzMT04
- ask others
Martin Henz, Tobias Müller, Sven Thiel: Global constraints for round robin tournament scheduling. European Journal of Operational Research 153(1): 92-101 (2004)
[j4]
- view
  - electronic edition @ bioinfo.de
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/isb/RateitschakMV04
- ask others
Katja Rateitschak, Tobias Müller, Martin Vingron: Annotating significant pairs of transcription factor binding sites in regulatory DNA. In Silico Biology 4 (2004)
2003
[c14]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/gcb/MullerRDW03
- ask others
Tobias Müller, Sven Rahmann, Thomas Dandekar, Matthias Wolf: Robust estimation of the phylogeny of Chlorophyceae(Chlorophyta)based on profile distances. German Conference on Bioinformatics 2003: 97-101
[c13]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/ida/SteinhoffMNV03
- ask others
Christine Steinhoff, Tobias Müller, Ulrike A. Nuber, Martin Vingron: Gaussian Mixture Density Estimation Applied to Microarray Data. IDA 2003: 418-429
2001
[c12]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/ismb/MullerRR01
- ask others
Tobias Müller, Sven Rahmann, Marc Rehmsmeier: Non-symmetric score matrices and the detection of homologous transmembrane proteins. ISMB (Supplement of Bioinformatics) 2001: 182-189
2000
[j3]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jcb/MullerV00
- ask others
Tobias Müller, Martin Vingron: Modeling Amino Acid Replacement. Journal of Computational Biology 7(6): 761-776 (2000)
[c11]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/cl/Muller00
- ask others
Tobias Müller: Promoting Constraints to First-Class Status. Computational Logic 2000: 429-447
[c10]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/cp/Muller00
- ask others
Tobias Müller: Practical Investigation of Constraints with Graph Views. CP 2000: 320-336
[c9]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/ecai/MelisZM00
- ask others
Erica Melis, Jürgen Zimmer, Tobias Müller: Extensions of Constraint Solving for Proof Planning. ECAI 2000: 229-233
[c8]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/frocos/MelisZM00
- ask others
Erica Melis, Jürgen Zimmer, Tobias Müller: Integrating Constraint Solving into Proof Planning. FroCoS 2000: 32-46

1990 – 1999

see FAQ

What is the meaning of the colors in the publication list?

1999
[j2]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/jflp/MullerW99
- ask others
Tobias Müller, Jörg Würtz: Embedding Propagators in a Concurrent Constraint Language. Journal of Functional and Logic Programming 1999(Special Issue 1) (1999)
[j1]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - journals/tcs/HenzB99
- ask others
Martin Henz, Tobias Müller, Ka Boon Ng: Figaro: Yet Another Constraint Programming Library. Electr. Notes Theor. Comput. Sci. 30(3): 93-105 (1999)
[c7]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/gcb/MullerSV99
- ask others
Tobias Müller, Rainer Spang, Martin Vingron: A new method for modeling protein evolution. German Conference on Bioinformatics 1999: 2-8
[c6]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/iclp/Muller99
- ask others
Tobias Müller: Practical Investigation of Constraints with Graph Views. ICLP 1999: 615
1997
[c5]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/iclp/MullerW97
- ask others
Tobias Müller, Jörg Würtz: Connecting Propagators with a Concurrent Constraint Language. ICLP 1997: 412
[c4]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/slp/MullerW97
- ask others
Tobias Müller, Jörg Würtz: Extending a Concurrent Constraint Language by Propagators. ILPS 1997: 149-163
[c3]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/wlp/MullerM97
- ask others
Tobias Müller, Martin Müller: Finite Set Intervals in Oz. WLP 1997: 17-19
1996
[c2]
- view
  - electronic edition via DOI
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/ki/WurtzM96
- ask others
Jörg Würtz, Tobias Müller: Constructive Disjunction Revisited. KI 1996: 377-386
1995
[c1]
- no documents available
- export record as
  - BibTeX
  - XML
  dblp key:
  - conf/wlp/MullerW95
- ask others
Tobias Müller, Jörg Würtz: Constructive Disjunction in Oz. WLP 1995: 113-122

Coauthor Index

see FAQ

What is the meaning of the colors in the coauthor index?